Brand: | Abnova |
Reference: | H00081631-M01 |
Product name: | MAP1LC3B monoclonal antibody (M01), clone 4E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP1LC3B. |
Clone: | 4E11 |
Isotype: | IgG2b Kappa |
Gene id: | 81631 |
Gene name: | MAP1LC3B |
Gene alias: | LC3B|MAP1A/1BLC3 |
Gene description: | microtubule-associated protein 1 light chain 3 beta |
Genbank accession: | NM_022818 |
Immunogen: | MAP1LC3B (NP_073729, 1 a.a. ~ 71 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL |
Protein accession: | NP_073729 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MAP1LC3B is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |