MAP1LC3B monoclonal antibody (M01), clone 4E11 View larger

MAP1LC3B monoclonal antibody (M01), clone 4E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP1LC3B monoclonal antibody (M01), clone 4E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about MAP1LC3B monoclonal antibody (M01), clone 4E11

Brand: Abnova
Reference: H00081631-M01
Product name: MAP1LC3B monoclonal antibody (M01), clone 4E11
Product description: Mouse monoclonal antibody raised against a partial recombinant MAP1LC3B.
Clone: 4E11
Isotype: IgG2b Kappa
Gene id: 81631
Gene name: MAP1LC3B
Gene alias: LC3B|MAP1A/1BLC3
Gene description: microtubule-associated protein 1 light chain 3 beta
Genbank accession: NM_022818
Immunogen: MAP1LC3B (NP_073729, 1 a.a. ~ 71 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL
Protein accession: NP_073729
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081631-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged MAP1LC3B is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MAP1LC3B monoclonal antibody (M01), clone 4E11 now

Add to cart