Brand: | Abnova |
Reference: | H00081631-A02 |
Product name: | MAP1LC3B polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant MAP1LC3B. |
Gene id: | 81631 |
Gene name: | MAP1LC3B |
Gene alias: | LC3B|MAP1A/1BLC3 |
Gene description: | microtubule-associated protein 1 light chain 3 beta |
Genbank accession: | BC018634 |
Immunogen: | MAP1LC3B (AAH18634, 1 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
Protein accession: | AAH18634 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.49 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |