TSC22D4 monoclonal antibody (M01), clone 1A4 View larger

TSC22D4 monoclonal antibody (M01), clone 1A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSC22D4 monoclonal antibody (M01), clone 1A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about TSC22D4 monoclonal antibody (M01), clone 1A4

Brand: Abnova
Reference: H00081628-M01
Product name: TSC22D4 monoclonal antibody (M01), clone 1A4
Product description: Mouse monoclonal antibody raised against a full length recombinant TSC22D4.
Clone: 1A4
Isotype: IgG2b Kappa
Gene id: 81628
Gene name: TSC22D4
Gene alias: THG-1|THG1
Gene description: TSC22 domain family, member 4
Genbank accession: BC001966
Immunogen: TSC22D4 (AAH01966, 1 a.a. ~ 395 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPDPGGKGTPRNGSPPPGAPSSRFRVVKLPHGLGEPYRRGRWTCVDVYERDLEPHSFGGLLEGIRGASGGAGGRSLDSRLELASLGLGAPTPPSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPSKAKAEKPPLSASSPQQRPPEPETGESAGTSRAATPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRELAERNAALEQENGLLRALASPEQLAQLPSSGVPRLGPPAPNGPSV
Protein accession: AAH01966
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081628-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (68.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081628-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TSC22D4 is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TSC22D4 monoclonal antibody (M01), clone 1A4 now

Add to cart