Brand: | Abnova |
Reference: | H00081624-M01 |
Product name: | DIAPH3 monoclonal antibody (M01), clone 4D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DIAPH3. |
Clone: | 4D5 |
Isotype: | IgG2a Kappa |
Gene id: | 81624 |
Gene name: | DIAPH3 |
Gene alias: | DKFZp434C0931|DKFZp686A13178|DRF3|Dia2|FLJ34705|diap3 |
Gene description: | diaphanous homolog 3 (Drosophila) |
Genbank accession: | NM_030932 |
Immunogen: | DIAPH3 (NP_112194, 632 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKV |
Protein accession: | NP_112194 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DIAPH3 is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |