DIAPH3 monoclonal antibody (M01), clone 4D5 View larger

DIAPH3 monoclonal antibody (M01), clone 4D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DIAPH3 monoclonal antibody (M01), clone 4D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about DIAPH3 monoclonal antibody (M01), clone 4D5

Brand: Abnova
Reference: H00081624-M01
Product name: DIAPH3 monoclonal antibody (M01), clone 4D5
Product description: Mouse monoclonal antibody raised against a partial recombinant DIAPH3.
Clone: 4D5
Isotype: IgG2a Kappa
Gene id: 81624
Gene name: DIAPH3
Gene alias: DKFZp434C0931|DKFZp686A13178|DRF3|Dia2|FLJ34705|diap3
Gene description: diaphanous homolog 3 (Drosophila)
Genbank accession: NM_030932
Immunogen: DIAPH3 (NP_112194, 632 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKV
Protein accession: NP_112194
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081624-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081624-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged DIAPH3 is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DIAPH3 monoclonal antibody (M01), clone 4D5 now

Add to cart