Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DIAPH3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about DIAPH3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00081624-A01 |
| Product name: | DIAPH3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DIAPH3. |
| Gene id: | 81624 |
| Gene name: | DIAPH3 |
| Gene alias: | DKFZp434C0931|DKFZp686A13178|DRF3|Dia2|FLJ34705|diap3 |
| Gene description: | diaphanous homolog 3 (Drosophila) |
| Genbank accession: | NM_030932 |
| Immunogen: | DIAPH3 (NP_112194, 632 a.a. ~ 729 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKV |
| Protein accession: | NP_112194 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | RhoD participates in the regulation of cell-cycle progression and centrosome duplication.Kyrkou A, Soufi M, Bahtz R, Ferguson C, Bai M, Parton RG, Hoffmann I, Zerial M, Fotsis T, Murphy C. Oncogene. 2012 Jun 4. doi: 10.1038/onc.2012.195. |