PVRL4 monoclonal antibody (M01A), clone 1D7 View larger

PVRL4 monoclonal antibody (M01A), clone 1D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PVRL4 monoclonal antibody (M01A), clone 1D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PVRL4 monoclonal antibody (M01A), clone 1D7

Brand: Abnova
Reference: H00081607-M01A
Product name: PVRL4 monoclonal antibody (M01A), clone 1D7
Product description: Mouse monoclonal antibody raised against a partial recombinant PVRL4.
Clone: 1D7
Isotype: IgM Kappa
Gene id: 81607
Gene name: PVRL4
Gene alias: LNIR|PRR4|nectin-4
Gene description: poliovirus receptor-related 4
Genbank accession: NM_030916
Immunogen: PVRL4 (NP_112178, 31 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AGELGTSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQA
Protein accession: NP_112178
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081607-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PVRL4 monoclonal antibody (M01A), clone 1D7 now

Add to cart