Brand: | Abnova |
Reference: | H00081602-M02 |
Product name: | CDADC1 monoclonal antibody (M02), clone 2E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDADC1. |
Clone: | 2E8 |
Isotype: | IgG1 Kappa |
Gene id: | 81602 |
Gene name: | CDADC1 |
Gene alias: | MGC150615|MGC41774|MGC57136|NYD-SP15|bA103J18.1 |
Gene description: | cytidine and dCMP deaminase domain containing 1 |
Genbank accession: | NM_030911 |
Immunogen: | CDADC1 (NP_112173, 423 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH |
Protein accession: | NP_112173 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | CDADC1 monoclonal antibody (M02), clone 2E8. Western Blot analysis of CDADC1 expression in PC-12 ( Cat # L012V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |