CDADC1 monoclonal antibody (M01), clone 1A2 View larger

CDADC1 monoclonal antibody (M01), clone 1A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDADC1 monoclonal antibody (M01), clone 1A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about CDADC1 monoclonal antibody (M01), clone 1A2

Brand: Abnova
Reference: H00081602-M01
Product name: CDADC1 monoclonal antibody (M01), clone 1A2
Product description: Mouse monoclonal antibody raised against a partial recombinant CDADC1.
Clone: 1A2
Isotype: IgG1 Kappa
Gene id: 81602
Gene name: CDADC1
Gene alias: MGC150615|MGC41774|MGC57136|NYD-SP15|bA103J18.1
Gene description: cytidine and dCMP deaminase domain containing 1
Genbank accession: NM_030911
Immunogen: CDADC1 (NP_112173, 423 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH
Protein accession: NP_112173
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081602-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00081602-M01-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CDADC1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy CDADC1 monoclonal antibody (M01), clone 1A2 now

Add to cart