Brand: | Abnova |
Reference: | H00081579-M01 |
Product name: | PLA2G12A monoclonal antibody (M01), clone 1D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PLA2G12A. |
Clone: | 1D11 |
Isotype: | IgG1 Kappa |
Gene id: | 81579 |
Gene name: | PLA2G12A |
Gene alias: | GXII|PLA2G12|ROSSY |
Gene description: | phospholipase A2, group XIIA |
Genbank accession: | NM_030821 |
Immunogen: | PLA2G12A (NP_110448, 90 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTD |
Protein accession: | NP_110448 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PLA2G12A is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Expression of group XIIA phospholipase A2 in human digestive organs.Peuravuori H, Kollanus S, Nevalainen TJ APMIS. 2014 Dec;122(12):1171-7. doi: 10.1111/apm.12280. Epub 2014 May 26. |