PLA2G12A monoclonal antibody (M01), clone 1D11 View larger

PLA2G12A monoclonal antibody (M01), clone 1D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLA2G12A monoclonal antibody (M01), clone 1D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PLA2G12A monoclonal antibody (M01), clone 1D11

Brand: Abnova
Reference: H00081579-M01
Product name: PLA2G12A monoclonal antibody (M01), clone 1D11
Product description: Mouse monoclonal antibody raised against a partial recombinant PLA2G12A.
Clone: 1D11
Isotype: IgG1 Kappa
Gene id: 81579
Gene name: PLA2G12A
Gene alias: GXII|PLA2G12|ROSSY
Gene description: phospholipase A2, group XIIA
Genbank accession: NM_030821
Immunogen: PLA2G12A (NP_110448, 90 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTD
Protein accession: NP_110448
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081579-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081579-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PLA2G12A is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Expression of group XIIA phospholipase A2 in human digestive organs.Peuravuori H, Kollanus S, Nevalainen TJ
APMIS. 2014 Dec;122(12):1171-7. doi: 10.1111/apm.12280. Epub 2014 May 26.

Reviews

Buy PLA2G12A monoclonal antibody (M01), clone 1D11 now

Add to cart