COL21A1 monoclonal antibody (M01), clone 1G6 View larger

COL21A1 monoclonal antibody (M01), clone 1G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COL21A1 monoclonal antibody (M01), clone 1G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about COL21A1 monoclonal antibody (M01), clone 1G6

Brand: Abnova
Reference: H00081578-M01
Product name: COL21A1 monoclonal antibody (M01), clone 1G6
Product description: Mouse monoclonal antibody raised against a partial recombinant COL21A1.
Clone: 1G6
Isotype: IgG2a Kappa
Gene id: 81578
Gene name: COL21A1
Gene alias: COLA1L|DKFZp564B052|FLJ39125|FLJ44623|FP633|MGC26619|dJ682J15.1|dJ708F5.1
Gene description: collagen, type XXI, alpha 1
Genbank accession: NM_030820
Immunogen: COL21A1 (NP_110447, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTSNVFPEGLPPSYVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKIL
Protein accession: NP_110447
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081578-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy COL21A1 monoclonal antibody (M01), clone 1G6 now

Add to cart