PDRG1 purified MaxPab mouse polyclonal antibody (B01P) View larger

PDRG1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDRG1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PDRG1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00081572-B01P
Product name: PDRG1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PDRG1 protein.
Gene id: 81572
Gene name: PDRG1
Gene alias: C20orf126|PDRG
Gene description: p53 and DNA damage regulated 1
Genbank accession: NM_030815.2
Immunogen: PDRG1 (NP_110442.1, 1 a.a. ~ 133 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG
Protein accession: NP_110442.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081572-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PDRG1 expression in transfected 293T cell line (H00081572-T01) by PDRG1 MaxPab polyclonal antibody.

Lane 1: PDRG1 transfected lysate(14.63 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PDRG1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart