Product successfully added to your shopping cart
Quantity
Total
There are 85 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 32 204,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 32 204,28 €
Data sheet of LMAN2L purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about LMAN2L purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00081562-B01P |
| Product name: | LMAN2L purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human LMAN2L protein. |
| Gene id: | 81562 |
| Gene name: | LMAN2L |
| Gene alias: | DKFZp564L2423|MGC11139|VIPL |
| Gene description: | lectin, mannose-binding 2-like |
| Genbank accession: | NM_030805 |
| Immunogen: | LMAN2L (NP_110432, 1 a.a. ~ 348 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY |
| Protein accession: | NP_110432 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of LMAN2L expression in transfected 293T cell line by LMAN2L MaxPab polyclonal antibody. Lane 1: LMAN2L transfected lysate(38.28 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |