Cart 64 Product Products 26 327,82 € (empty)
No products
To be determined Shipping
26 327,82 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 64 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 26 327,82 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 26 327,82 €
Data sheet of WBSCR16 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about WBSCR16 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00081554-B01P |
| Product name: | WBSCR16 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human WBSCR16 protein. |
| Gene id: | 81554 |
| Gene name: | WBSCR16 |
| Gene alias: | DKFZp434D0421|MGC189739|MGC44931 |
| Gene description: | Williams-Beuren syndrome chromosome region 16 |
| Genbank accession: | BC007823 |
| Immunogen: | WBSCR16 (AAH07823.1, 1 a.a. ~ 464 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MALVALVAGARLGRRLSGPGLGRGHWTAAGRSRSRREAAEAEAEVPVVQYVGERAARADRVFVWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQKISSAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDLAGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHFSGVGKVRQAACGGTGCAVLNGEGHVFVWGYGILGKGPNLVESAVPEMIPPTLFGLTEFNPEIQVSRIRCGLSHFAALTNKGELFVWGKNIRGCLGIGRLEDQYFPWRVTMPGEPVDVACGVDHMVTLAKSFI |
| Protein accession: | AAH07823.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of WBSCR16 expression in transfected 293T cell line (H00081554-T02) by WBSCR16 MaxPab polyclonal antibody. Lane 1: WBSCR16 transfected lysate(51.04 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |