WBSCR16 MaxPab mouse polyclonal antibody (B01) View larger

WBSCR16 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WBSCR16 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about WBSCR16 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00081554-B01
Product name: WBSCR16 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human WBSCR16 protein.
Gene id: 81554
Gene name: WBSCR16
Gene alias: DKFZp434D0421|MGC189739|MGC44931
Gene description: Williams-Beuren syndrome chromosome region 16
Genbank accession: BC007823
Immunogen: WBSCR16 (AAH07823, 1 a.a. ~ 464 a.a) full-length human protein.
Immunogen sequence/protein sequence: MALVALVAGARLGRRLSGPGLGRGHWTAAGRSRSRREAAEAEAEVPVVQYVGERAARADRVFVWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQKISSAACGYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDKGEVYSCGWGADGQTGLGHYNITSSPTKLGGDLAGVNVIQVATYGDCCLAVSADGGLFGWGNSEYLQLASVTDSTQVNVPRCLHFSGVGKVRQAACGGTGCAVLNGEGHVFVWGYGILGKGPNLVESAVPEMIPPTLFGLTEFNPEIQVSRIRCGLSHFAALTNKGELFVWGKNIRGCLGIGRLEDQYFPWRVTMPGEPVDVACGVDHMVTLAKSFI
Protein accession: AAH07823
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081554-B01-13-15-1.jpg
Application image note: Western Blot analysis of WBSCR16 expression in transfected 293T cell line (H00081554-T01) by WBSCR16 MaxPab polyclonal antibody.

Lane 1: WBSCR16 transfected lysate(51.04 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WBSCR16 MaxPab mouse polyclonal antibody (B01) now

Add to cart