RSHL1 monoclonal antibody (M02), clone 3D12 View larger

RSHL1 monoclonal antibody (M02), clone 3D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RSHL1 monoclonal antibody (M02), clone 3D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RSHL1 monoclonal antibody (M02), clone 3D12

Brand: Abnova
Reference: H00081492-M02
Product name: RSHL1 monoclonal antibody (M02), clone 3D12
Product description: Mouse monoclonal antibody raised against a partial recombinant RSHL1.
Clone: 3D12
Isotype: IgG2a Kappa
Gene id: 81492
Gene name: RSHL1
Gene alias: RSP4|RSP6
Gene description: radial spokehead-like 1
Genbank accession: NM_030785
Immunogen: RSHL1 (NP_110412, 21 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SQASQRRHSRDQAQALAADPEERQQIPPDAQRNAPGWSQRGSLSQQENLLMPQVFQAEEARLGGMEYPSVNTGFPSEFQPQPYSDESRMQVAE
Protein accession: NP_110412
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081492-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081492-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged RSHL1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RSHL1 monoclonal antibody (M02), clone 3D12 now

Add to cart