GRINL1A monoclonal antibody (M04), clone 2E4 View larger

GRINL1A monoclonal antibody (M04), clone 2E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRINL1A monoclonal antibody (M04), clone 2E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about GRINL1A monoclonal antibody (M04), clone 2E4

Brand: Abnova
Reference: H00081488-M04
Product name: GRINL1A monoclonal antibody (M04), clone 2E4
Product description: Mouse monoclonal antibody raised against a partial recombinant GRINL1A.
Clone: 2E4
Isotype: IgG2a Kappa
Gene id: 81488
Gene name: GRINL1A
Gene alias: DKFZp586F1918
Gene description: glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A
Genbank accession: NM_015532
Immunogen: GRINL1A (NP_056347.1, 269 a.a. ~ 368 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GSPISSEERRRRDKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESSGRYREVRDEDDDWSSDEF
Protein accession: NP_056347.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081488-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081488-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged GRINL1A is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GRINL1A monoclonal antibody (M04), clone 2E4 now

Add to cart