OR51E2 (Human) Recombinant Protein (Q01) View larger

OR51E2 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OR51E2 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
ApplicationsAP,Array,ELISA,WB-Re

More info about OR51E2 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00081285-Q01
Product name: OR51E2 (Human) Recombinant Protein (Q01)
Product description: Human OR51E2 partial ORF (NP_110401.1, 221 a.a. - 320 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 81285
Gene name: OR51E2
Gene alias: OR51E3P|OR52A2|PSGR
Gene description: olfactory receptor, family 51, subfamily E, member 2
Genbank accession: NM_030774.2
Immunogen sequence/protein sequence: IRTVLQLPSKSERAKAFGTCVSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK
Protein accession: NP_110401.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00081285-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OR51E2 (Human) Recombinant Protein (Q01) now

Add to cart