COLEC12 monoclonal antibody (M01), clone 4A7 View larger

COLEC12 monoclonal antibody (M01), clone 4A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COLEC12 monoclonal antibody (M01), clone 4A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about COLEC12 monoclonal antibody (M01), clone 4A7

Brand: Abnova
Reference: H00081035-M01
Product name: COLEC12 monoclonal antibody (M01), clone 4A7
Product description: Mouse monoclonal antibody raised against a partial recombinant COLEC12.
Clone: 4A7
Isotype: IgG2a Kappa
Gene id: 81035
Gene name: COLEC12
Gene alias: CLP1|NSR2|SCARA4|SRCL
Gene description: collectin sub-family member 12
Genbank accession: BC060789
Immunogen: COLEC12 (AAH60789, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHN
Protein accession: AAH60789
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081035-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081035-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged COLEC12 is 0.3 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy COLEC12 monoclonal antibody (M01), clone 4A7 now

Add to cart