ZBP1 monoclonal antibody (M01), clone 2C10 View larger

ZBP1 monoclonal antibody (M01), clone 2C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZBP1 monoclonal antibody (M01), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ZBP1 monoclonal antibody (M01), clone 2C10

Brand: Abnova
Reference: H00081030-M01
Product name: ZBP1 monoclonal antibody (M01), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant ZBP1.
Clone: 2C10
Isotype: IgG1 Kappa
Gene id: 81030
Gene name: ZBP1
Gene alias: C20orf183|DAI|DLM-1|DLM1
Gene description: Z-DNA binding protein 1
Genbank accession: NM_030776
Immunogen: ZBP1 (NP_110403.1, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPET
Protein accession: NP_110403.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00081030-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00081030-M01-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ZBP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZBP1 monoclonal antibody (M01), clone 2C10 now

Add to cart