TMPRSS5 monoclonal antibody (M09), clone 2E5 View larger

TMPRSS5 monoclonal antibody (M09), clone 2E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMPRSS5 monoclonal antibody (M09), clone 2E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Tr

More info about TMPRSS5 monoclonal antibody (M09), clone 2E5

Brand: Abnova
Reference: H00080975-M09
Product name: TMPRSS5 monoclonal antibody (M09), clone 2E5
Product description: Mouse monoclonal antibody raised against a partial recombinant TMPRSS5.
Clone: 2E5
Isotype: IgG1 Kappa
Gene id: 80975
Gene name: TMPRSS5
Gene alias: MGC141886|MGC148044|SPINESIN
Gene description: transmembrane protease, serine 5
Genbank accession: NM_030770
Immunogen: TMPRSS5 (NP_110397.1, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYS
Protein accession: NP_110397.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080975-M09-2-A0-1.jpg
Application image note: TMPRSS5 monoclonal antibody (M09), clone 2E5. Western Blot analysis of TMPRSS5 expression in human kidney.
Applications: WB-Ti,S-ELISA,ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TMPRSS5 monoclonal antibody (M09), clone 2E5 now

Add to cart