ILKAP monoclonal antibody (M02), clone 3B5 View larger

ILKAP monoclonal antibody (M02), clone 3B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ILKAP monoclonal antibody (M02), clone 3B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about ILKAP monoclonal antibody (M02), clone 3B5

Brand: Abnova
Reference: H00080895-M02
Product name: ILKAP monoclonal antibody (M02), clone 3B5
Product description: Mouse monoclonal antibody raised against a partial recombinant ILKAP.
Clone: 3B5
Isotype: IgG2b Kappa
Gene id: 80895
Gene name: ILKAP
Gene alias: DKFZp434J2031|FLJ10181|MGC4846|PP2C-DELTA
Gene description: integrin-linked kinase-associated serine/threonine phosphatase 2C
Genbank accession: NM_030768
Immunogen: ILKAP (NP_110395, 293 a.a. ~ 392 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH
Protein accession: NP_110395
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080895-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080895-M02-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ILKAP on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ILKAP monoclonal antibody (M02), clone 3B5 now

Add to cart