SET7 monoclonal antibody (M01), clone 5B4 View larger

SET7 monoclonal antibody (M01), clone 5B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SET7 monoclonal antibody (M01), clone 5B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about SET7 monoclonal antibody (M01), clone 5B4

Brand: Abnova
Reference: H00080854-M01
Product name: SET7 monoclonal antibody (M01), clone 5B4
Product description: Mouse monoclonal antibody raised against a partial recombinant SET7.
Clone: 5B4
Isotype: IgG2a Kappa
Gene id: 80854
Gene name: SETD7
Gene alias: FLJ21193|KIAA1717|KMT7|SET7|SET7/9|SET9
Gene description: SET domain containing (lysine methyltransferase) 7
Genbank accession: NM_030648
Immunogen: SET7 (NP_085151, 257 a.a. ~ 366 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK
Protein accession: NP_085151
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080854-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080854-M01-1-6-1.jpg
Application image note: SET7 monoclonal antibody (M01), clone 5B4 Western Blot analysis of SET7 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SET7 monoclonal antibody (M01), clone 5B4 now

Add to cart