APOL3 monoclonal antibody (M02), clone 8F5 View larger

APOL3 monoclonal antibody (M02), clone 8F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOL3 monoclonal antibody (M02), clone 8F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about APOL3 monoclonal antibody (M02), clone 8F5

Brand: Abnova
Reference: H00080833-M02
Product name: APOL3 monoclonal antibody (M02), clone 8F5
Product description: Mouse monoclonal antibody raised against a partial recombinant APOL3.
Clone: 8F5
Isotype: IgG2a Kappa
Gene id: 80833
Gene name: APOL3
Gene alias: APOLIII|CG12-1
Gene description: apolipoprotein L, 3
Genbank accession: NM_145640
Immunogen: APOL3 (NP_663615, 240 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRG
Protein accession: NP_663615
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080833-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy APOL3 monoclonal antibody (M02), clone 8F5 now

Add to cart