Brand: | Abnova |
Reference: | H00080833-M01A |
Product name: | APOL3 monoclonal antibody (M01A), clone 4E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant APOL3. |
Clone: | 4E5 |
Isotype: | IgG2a Kappa |
Gene id: | 80833 |
Gene name: | APOL3 |
Gene alias: | APOLIII|CG12-1 |
Gene description: | apolipoprotein L, 3 |
Genbank accession: | NM_145640 |
Immunogen: | APOL3 (NP_663615, 240 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRG |
Protein accession: | NP_663615 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | APOL3 monoclonal antibody (M01A), clone 4E5 Western Blot analysis of APOL3 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |