APOL4 purified MaxPab mouse polyclonal antibody (B01P) View larger

APOL4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOL4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about APOL4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00080832-B01P
Product name: APOL4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human APOL4 protein.
Gene id: 80832
Gene name: APOL4
Gene alias: APOL-IV|APOLIV
Gene description: apolipoprotein L, 4
Genbank accession: ENST00000328429
Immunogen: APOL4 (ENSP00000331089, 1 a.a. ~ 107 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV
Protein accession: ENSP00000331089
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080832-B01P-13-15-1.jpg
Application image note: Western Blot analysis of APOL4 expression in transfected 293T cell line (H00080832-T02) by APOL4 MaxPab polyclonal antibody.

Lane 1: APOL4 transfected lysate(11.77 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy APOL4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart