APOL6 monoclonal antibody (M03), clone 1F7 View larger

APOL6 monoclonal antibody (M03), clone 1F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOL6 monoclonal antibody (M03), clone 1F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about APOL6 monoclonal antibody (M03), clone 1F7

Brand: Abnova
Reference: H00080830-M03
Product name: APOL6 monoclonal antibody (M03), clone 1F7
Product description: Mouse monoclonal antibody raised against a partial recombinant APOL6.
Clone: 1F7
Isotype: IgG2a Kappa
Gene id: 80830
Gene name: APOL6
Gene alias: APOL-VI|APOLVI|DKFZp667M075|FLJ38562|FLJ90164|MGC57495
Gene description: apolipoprotein L, 6
Genbank accession: NM_030641
Immunogen: APOL6 (NP_085144.1, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLKEDLKGNIDKLRALADDIDKTHKKFTK
Protein accession: NP_085144.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080830-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080830-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged APOL6 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy APOL6 monoclonal antibody (M03), clone 1F7 now

Add to cart