DUSP16 monoclonal antibody (M04), clone 3F3 View larger

DUSP16 monoclonal antibody (M04), clone 3F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP16 monoclonal antibody (M04), clone 3F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about DUSP16 monoclonal antibody (M04), clone 3F3

Brand: Abnova
Reference: H00080824-M04
Product name: DUSP16 monoclonal antibody (M04), clone 3F3
Product description: Mouse monoclonal antibody raised against a partial recombinant DUSP16.
Clone: 3F3
Isotype: IgG2a Kappa
Gene id: 80824
Gene name: DUSP16
Gene alias: KIAA1700|MGC129701|MGC129702|MKP-7|MKP7
Gene description: dual specificity phosphatase 16
Genbank accession: NM_030640
Immunogen: DUSP16 (NP_085143.1, 561 a.a. ~ 665 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSMEIIEVS
Protein accession: NP_085143.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080824-M04-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DUSP16 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy DUSP16 monoclonal antibody (M04), clone 3F3 now

Add to cart