H00080765-B02P_50ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00080765-B02P |
Product name: | STARD5 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human STARD5 protein. |
Gene id: | 80765 |
Gene name: | STARD5 |
Gene alias: | MGC10327 |
Gene description: | StAR-related lipid transfer (START) domain containing 5 |
Genbank accession: | NM_181900.2 |
Immunogen: | STARD5 (NP_871629.1, 1 a.a. ~ 213 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE |
Protein accession: | NP_871629.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of STARD5 expression in transfected 293T cell line (H00080765-T02) by STARD5 MaxPab polyclonal antibody. Lane 1: STARD5 transfected lysate(23.80 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |