TSGA10 monoclonal antibody (M08), clone 6E8 View larger

TSGA10 monoclonal antibody (M08), clone 6E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSGA10 monoclonal antibody (M08), clone 6E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about TSGA10 monoclonal antibody (M08), clone 6E8

Brand: Abnova
Reference: H00080705-M08
Product name: TSGA10 monoclonal antibody (M08), clone 6E8
Product description: Mouse monoclonal antibody raised against a partial recombinant TSGA10.
Clone: 6E8
Isotype: IgG2a Kappa
Gene id: 80705
Gene name: TSGA10
Gene alias: CEP4L
Gene description: testis specific, 10
Genbank accession: NM_025244
Immunogen: TSGA10 (NP_079520, 599 a.a. ~ 698 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF
Protein accession: NP_079520
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080705-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080705-M08-42-R01V-1.jpg
Application image note: Western blot analysis of TSGA10 over-expressed 293 cell line, cotransfected with TSGA10 Validated Chimera RNAi ( Cat # H00080705-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TSGA10 monoclonal antibody (M08), clone 6E8 (Cat # H00080705-M08 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: IF,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy TSGA10 monoclonal antibody (M08), clone 6E8 now

Add to cart