SLC19A3 monoclonal antibody (M07), clone 3B2 View larger

SLC19A3 monoclonal antibody (M07), clone 3B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC19A3 monoclonal antibody (M07), clone 3B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about SLC19A3 monoclonal antibody (M07), clone 3B2

Brand: Abnova
Reference: H00080704-M07
Product name: SLC19A3 monoclonal antibody (M07), clone 3B2
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC19A3.
Clone: 3B2
Isotype: IgG1 Kappa
Gene id: 80704
Gene name: SLC19A3
Gene alias: THTR2
Gene description: solute carrier family 19, member 3
Genbank accession: NM_025243
Immunogen: SLC19A3 (NP_079519.1, 191 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKR
Protein accession: NP_079519.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080704-M07-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC19A3 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SLC19A3 monoclonal antibody (M07), clone 3B2 now

Add to cart