Brand: | Abnova |
Reference: | H00080704-M07 |
Product name: | SLC19A3 monoclonal antibody (M07), clone 3B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC19A3. |
Clone: | 3B2 |
Isotype: | IgG1 Kappa |
Gene id: | 80704 |
Gene name: | SLC19A3 |
Gene alias: | THTR2 |
Gene description: | solute carrier family 19, member 3 |
Genbank accession: | NM_025243 |
Immunogen: | SLC19A3 (NP_079519.1, 191 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKR |
Protein accession: | NP_079519.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC19A3 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |