CD276 monoclonal antibody (M20), clone 1B8 View larger

CD276 monoclonal antibody (M20), clone 1B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD276 monoclonal antibody (M20), clone 1B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about CD276 monoclonal antibody (M20), clone 1B8

Brand: Abnova
Reference: H00080381-M20
Product name: CD276 monoclonal antibody (M20), clone 1B8
Product description: Mouse monoclonal antibody raised against a partial recombinant CD276.
Clone: 1B8
Isotype: IgG1 Kappa
Gene id: 80381
Gene name: CD276
Gene alias: B7-H3|B7H3
Gene description: CD276 molecule
Genbank accession: BC062581.1
Immunogen: CD276 (AAH62581.1, 237 a.a. ~ 358 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: ITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAA
Protein accession: AAH62581.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy CD276 monoclonal antibody (M20), clone 1B8 now

Add to cart