CD276 monoclonal antibody (M14), clone 1A6 View larger

CD276 monoclonal antibody (M14), clone 1A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD276 monoclonal antibody (M14), clone 1A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re

More info about CD276 monoclonal antibody (M14), clone 1A6

Brand: Abnova
Reference: H00080381-M14
Product name: CD276 monoclonal antibody (M14), clone 1A6
Product description: Mouse monoclonal antibody raised against a partial recombinant CD276.
Clone: 1A6
Isotype: IgG1 Kappa
Gene id: 80381
Gene name: CD276
Gene alias: B7-H3|B7H3
Gene description: CD276 molecule
Genbank accession: BC062581.1
Immunogen: CD276 (AAH62581.1, 237 a.a. ~ 358 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: ITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAA
Protein accession: AAH62581.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080381-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (15.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00080381-M14-1-27-1.jpg
Application image note: CD276 monoclonal antibody (M14), clone 1A6. Western Blot analysis of CD276 expression in Raw 264.7.
Applications: WB-Ce,WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD276 monoclonal antibody (M14), clone 1A6 now

Add to cart