CD276 monoclonal antibody (M09), clone 7C10 View larger

CD276 monoclonal antibody (M09), clone 7C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD276 monoclonal antibody (M09), clone 7C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about CD276 monoclonal antibody (M09), clone 7C10

Brand: Abnova
Reference: H00080381-M09
Product name: CD276 monoclonal antibody (M09), clone 7C10
Product description: Mouse monoclonal antibody raised against a partial recombinant CD276.
Clone: 7C10
Isotype: IgG1 Kappa
Gene id: 80381
Gene name: CD276
Gene alias: B7-H3|B7H3
Gene description: CD276 molecule
Genbank accession: BC062581.1
Immunogen: CD276 (AAH62581.1, 28 a.a. ~ 238 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: ALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTIT
Protein accession: AAH62581.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080381-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (26.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080381-M09-4-7-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to CD276 on MCF-7 cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD276 monoclonal antibody (M09), clone 7C10 now

Add to cart