PDCD1LG2 monoclonal antibody (M17), clone 1F12 View larger

PDCD1LG2 monoclonal antibody (M17), clone 1F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDCD1LG2 monoclonal antibody (M17), clone 1F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about PDCD1LG2 monoclonal antibody (M17), clone 1F12

Brand: Abnova
Reference: H00080380-M17
Product name: PDCD1LG2 monoclonal antibody (M17), clone 1F12
Product description: Mouse monoclonal antibody raised against a partial recombinant PDCD1LG2.
Clone: 1F12
Isotype: IgG1 Kappa
Gene id: 80380
Gene name: PDCD1LG2
Gene alias: B7DC|Btdc|CD273|MGC142238|MGC142240|PD-L2|PDCD1L2|PDL2|bA574F11.2
Gene description: programmed cell death 1 ligand 2
Genbank accession: BC074766.2
Immunogen: PDCD1LG2 (AAH74766.1, 19 a.a. ~ 121 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKA
Protein accession: AAH74766.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy PDCD1LG2 monoclonal antibody (M17), clone 1F12 now

Add to cart