Brand: | Abnova |
Reference: | H00080380-M13 |
Product name: | PDCD1LG2 monoclonal antibody (M13), clone 1E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PDCD1LG2. |
Clone: | 1E9 |
Isotype: | IgG1 Kappa |
Gene id: | 80380 |
Gene name: | PDCD1LG2 |
Gene alias: | B7DC|Btdc|CD273|MGC142238|MGC142240|PD-L2|PDCD1L2|PDL2|bA574F11.2 |
Gene description: | programmed cell death 1 ligand 2 |
Genbank accession: | BC074766.2 |
Immunogen: | PDCD1LG2 (AAH74766.1, 19 a.a. ~ 121 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | ALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKA |
Protein accession: | AAH74766.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |