PDCD1LG2 monoclonal antibody (M06), clone 7D5 View larger

PDCD1LG2 monoclonal antibody (M06), clone 7D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDCD1LG2 monoclonal antibody (M06), clone 7D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PDCD1LG2 monoclonal antibody (M06), clone 7D5

Brand: Abnova
Reference: H00080380-M06
Product name: PDCD1LG2 monoclonal antibody (M06), clone 7D5
Product description: Mouse monoclonal antibody raised against a partial recombinant PDCD1LG2.
Clone: 7D5
Isotype: IgG2a Kappa
Gene id: 80380
Gene name: PDCD1LG2
Gene alias: B7DC|Btdc|CD273|MGC142238|MGC142240|PD-L2|PDCD1L2|PDL2|bA574F11.2
Gene description: programmed cell death 1 ligand 2
Genbank accession: NM_025239
Immunogen: PDCD1LG2 (NP_079515.1, 22 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWD
Protein accession: NP_079515.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080380-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080380-M06-13-15-1.jpg
Application image note: Western Blot analysis of PDCD1LG2 expression in transfected 293T cell line by PDCD1LG2 monoclonal antibody (M06), clone 7D5.

Lane 1: PDCD1LG2 transfected lysate (Predicted MW: 30.03 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PDCD1LG2 monoclonal antibody (M06), clone 7D5 now

Add to cart