REC14 monoclonal antibody (M01), clone 3E5-1A12 View larger

REC14 monoclonal antibody (M01), clone 3E5-1A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of REC14 monoclonal antibody (M01), clone 3E5-1A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about REC14 monoclonal antibody (M01), clone 3E5-1A12

Brand: Abnova
Reference: H00080349-M01
Product name: REC14 monoclonal antibody (M01), clone 3E5-1A12
Product description: Mouse monoclonal antibody raised against a full length recombinant REC14.
Clone: 3E5-1A12
Isotype: IgG2b kappa
Gene id: 80349
Gene name: WDR61
Gene alias: REC14|SKI8
Gene description: WD repeat domain 61
Genbank accession: BC010080
Immunogen: REC14 (AAH10080, 1 a.a. ~ 305 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPI
Protein accession: AAH10080
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080349-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (59.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080349-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to WDR61 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy REC14 monoclonal antibody (M01), clone 3E5-1A12 now

Add to cart