ZNF435 monoclonal antibody (M01), clone 4A9 View larger

ZNF435 monoclonal antibody (M01), clone 4A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF435 monoclonal antibody (M01), clone 4A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF435 monoclonal antibody (M01), clone 4A9

Brand: Abnova
Reference: H00080345-M01
Product name: ZNF435 monoclonal antibody (M01), clone 4A9
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF435.
Clone: 4A9
Isotype: IgG2b Kappa
Gene id: 80345
Gene name: ZSCAN16
Gene alias: FLJ22191|ZNF392|ZNF435|dJ265C24.3
Gene description: zinc finger and SCAN domain containing 16
Genbank accession: NM_025231
Immunogen: ZNF435 (NP_079507.1, 132 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GNSERRDILMDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQ
Protein accession: NP_079507.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080345-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080345-M01-13-15-1.jpg
Application image note: Western Blot analysis of ZSCAN16 expression in transfected 293T cell line by ZNF435 monoclonal antibody (M01), clone 4A9.

Lane 1: ZSCAN16 transfected lysate(40.8 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF435 monoclonal antibody (M01), clone 4A9 now

Add to cart