Brand: | Abnova |
Reference: | H00080342-M01 |
Product name: | TRAF3IP3 monoclonal antibody (M01), clone 7E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRAF3IP3. |
Clone: | 7E10 |
Isotype: | IgG2a Lambda |
Gene id: | 80342 |
Gene name: | TRAF3IP3 |
Gene alias: | DJ434O14.3|FLJ44151|MGC117354|MGC163289|T3JAM |
Gene description: | TRAF3 interacting protein 3 |
Genbank accession: | NM_025228 |
Immunogen: | TRAF3IP3 (NP_079504.1, 231 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NQLYTCTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKL |
Protein accession: | NP_079504.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TRAF3IP3 monoclonal antibody (M01), clone 7E10. Western Blot analysis of TRAF3IP3 expression in Jurkat. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |