TRAF3IP3 monoclonal antibody (M01), clone 7E10 View larger

TRAF3IP3 monoclonal antibody (M01), clone 7E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRAF3IP3 monoclonal antibody (M01), clone 7E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about TRAF3IP3 monoclonal antibody (M01), clone 7E10

Brand: Abnova
Reference: H00080342-M01
Product name: TRAF3IP3 monoclonal antibody (M01), clone 7E10
Product description: Mouse monoclonal antibody raised against a partial recombinant TRAF3IP3.
Clone: 7E10
Isotype: IgG2a Lambda
Gene id: 80342
Gene name: TRAF3IP3
Gene alias: DJ434O14.3|FLJ44151|MGC117354|MGC163289|T3JAM
Gene description: TRAF3 interacting protein 3
Genbank accession: NM_025228
Immunogen: TRAF3IP3 (NP_079504.1, 231 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NQLYTCTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKL
Protein accession: NP_079504.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080342-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080342-M01-1-6-1.jpg
Application image note: TRAF3IP3 monoclonal antibody (M01), clone 7E10. Western Blot analysis of TRAF3IP3 expression in Jurkat.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TRAF3IP3 monoclonal antibody (M01), clone 7E10 now

Add to cart