KCNIP4 monoclonal antibody (M01), clone 1A11 View larger

KCNIP4 monoclonal antibody (M01), clone 1A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNIP4 monoclonal antibody (M01), clone 1A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about KCNIP4 monoclonal antibody (M01), clone 1A11

Brand: Abnova
Reference: H00080333-M01
Product name: KCNIP4 monoclonal antibody (M01), clone 1A11
Product description: Mouse monoclonal antibody raised against a full length recombinant KCNIP4.
Clone: 1A11
Isotype: IgG1 kappa
Gene id: 80333
Gene name: KCNIP4
Gene alias: CALP|KCHIP4|MGC44947
Gene description: Kv channel interacting protein 4
Genbank accession: BC032520
Immunogen: KCNIP4 (AAH32520, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
Protein accession: AAH32520
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080333-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (53.24 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080333-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to KCNIP4 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KCNIP4 monoclonal antibody (M01), clone 1A11 now

Add to cart