Brand: | Abnova |
Reference: | H00080332-A01 |
Product name: | ADAM33 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ADAM33. |
Gene id: | 80332 |
Gene name: | ADAM33 |
Gene alias: | C20orf153|DJ964F7.1|DKFZp434K0521|FLJ35308|FLJ36751|MGC149823|MGC71889 |
Gene description: | ADAM metallopeptidase domain 33 |
Genbank accession: | NM_025220 |
Immunogen: | ADAM33 (NP_079496, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | AHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQEL |
Protein accession: | NP_079496 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |