ABTB1 monoclonal antibody (M02), clone 2A10 View larger

ABTB1 monoclonal antibody (M02), clone 2A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABTB1 monoclonal antibody (M02), clone 2A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about ABTB1 monoclonal antibody (M02), clone 2A10

Brand: Abnova
Reference: H00080325-M02
Product name: ABTB1 monoclonal antibody (M02), clone 2A10
Product description: Mouse monoclonal antibody raised against a partial recombinant ABTB1.
Clone: 2A10
Isotype: IgG2a Kappa
Gene id: 80325
Gene name: ABTB1
Gene alias: BPOZ|Btb3|EF1ABP|MGC20585|PP2259
Gene description: ankyrin repeat and BTB (POZ) domain containing 1
Genbank accession: NM_172027
Immunogen: ABTB1 (NP_742024, 271 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR
Protein accession: NP_742024
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080325-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ABTB1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy ABTB1 monoclonal antibody (M02), clone 2A10 now

Add to cart