Brand: | Abnova |
Reference: | H00080317-M09 |
Product name: | ZNF306 monoclonal antibody (M09), clone 2A1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF306. |
Clone: | 2A1 |
Isotype: | IgG2a Kappa |
Gene id: | 80317 |
Gene name: | ZKSCAN3 |
Gene alias: | FLJ33906|KIAA0426|ZF47|ZFP306|ZNF306|ZNF309|ZSCAN13|Zfp47|dJ874C20.1 |
Gene description: | zinc finger with KRAB and SCAN domains 3 |
Genbank accession: | NM_024493 |
Immunogen: | ZNF306 (NP_077819, 431 a.a. ~ 536 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFTQNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNIL |
Protein accession: | NP_077819 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |