ZNF306 monoclonal antibody (M09), clone 2A1 View larger

ZNF306 monoclonal antibody (M09), clone 2A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF306 monoclonal antibody (M09), clone 2A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ZNF306 monoclonal antibody (M09), clone 2A1

Brand: Abnova
Reference: H00080317-M09
Product name: ZNF306 monoclonal antibody (M09), clone 2A1
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF306.
Clone: 2A1
Isotype: IgG2a Kappa
Gene id: 80317
Gene name: ZKSCAN3
Gene alias: FLJ33906|KIAA0426|ZF47|ZFP306|ZNF306|ZNF309|ZSCAN13|Zfp47|dJ874C20.1
Gene description: zinc finger with KRAB and SCAN domains 3
Genbank accession: NM_024493
Immunogen: ZNF306 (NP_077819, 431 a.a. ~ 536 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFTQNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNIL
Protein accession: NP_077819
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080317-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF306 monoclonal antibody (M09), clone 2A1 now

Add to cart