TET1 monoclonal antibody (M01), clone 4F4 View larger

TET1 monoclonal antibody (M01), clone 4F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TET1 monoclonal antibody (M01), clone 4F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TET1 monoclonal antibody (M01), clone 4F4

Brand: Abnova
Reference: H00080312-M01
Product name: TET1 monoclonal antibody (M01), clone 4F4
Product description: Mouse monoclonal antibody raised against a partial recombinant TET1.
Clone: 4F4
Isotype: IgG2a Kappa
Gene id: 80312
Gene name: TET1
Gene alias: CXXC6|FLJ10839|FLJ41442|KIAA1676|LCX|bA119F7.1
Gene description: tet oncogene 1
Genbank accession: NM_030625
Immunogen: TET1 (NP_085128.1, 2038 a.a. ~ 2136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RNHPTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNELNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV
Protein accession: NP_085128.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080312-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080312-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TET1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TET1 monoclonal antibody (M01), clone 4F4 now

Add to cart