EFHD1 monoclonal antibody (M11), clone 3D10 View larger

EFHD1 monoclonal antibody (M11), clone 3D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EFHD1 monoclonal antibody (M11), clone 3D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about EFHD1 monoclonal antibody (M11), clone 3D10

Brand: Abnova
Reference: H00080303-M11
Product name: EFHD1 monoclonal antibody (M11), clone 3D10
Product description: Mouse monoclonal antibody raised against a partial recombinant EFHD1.
Clone: 3D10
Isotype: IgG2a Kappa
Gene id: 80303
Gene name: EFHD1
Gene alias: DKFZp781H0842|FLJ13612|MST133|MSTP133|PP3051
Gene description: EF-hand domain family, member D1
Genbank accession: NM_025202
Immunogen: EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN
Protein accession: NP_079478.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080303-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080303-M11-13-15-1.jpg
Application image note: Western Blot analysis of EFHD1 expression in transfected 293T cell line by EFHD1 monoclonal antibody (M11), clone 3D10.

Lane 1: EFHD1 transfected lysate(27 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EFHD1 monoclonal antibody (M11), clone 3D10 now

Add to cart