Brand: | Abnova |
Reference: | H00080303-M08A |
Product name: | EFHD1 monoclonal antibody (M08A), clone 1F5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EFHD1. |
Clone: | 1F5 |
Isotype: | IgG2a Kappa |
Gene id: | 80303 |
Gene name: | EFHD1 |
Gene alias: | DKFZp781H0842|FLJ13612|MST133|MSTP133|PP3051 |
Gene description: | EF-hand domain family, member D1 |
Genbank accession: | NM_025202 |
Immunogen: | EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN |
Protein accession: | NP_079478.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00080303-M08A-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00080303-M08A-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (33.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![H00080303-M08A-1-8-1.jpg](http://www.abnova.com/application_image/H00080303-M08A-1-8-1.jpg) |
Application image note: | EFHD1 monoclonal antibody (M08A), clone 1F5. Western Blot analysis of EFHD1 expression in NIH/3T3(Cat # L018V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |