EFHD1 monoclonal antibody (M05), clone 1H7 View larger

EFHD1 monoclonal antibody (M05), clone 1H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EFHD1 monoclonal antibody (M05), clone 1H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,ELISA,WB-Re

More info about EFHD1 monoclonal antibody (M05), clone 1H7

Brand: Abnova
Reference: H00080303-M05
Product name: EFHD1 monoclonal antibody (M05), clone 1H7
Product description: Mouse monoclonal antibody raised against a full length recombinant EFHD1.
Clone: 1H7
Isotype: IgG2a Kappa
Gene id: 80303
Gene name: EFHD1
Gene alias: DKFZp781H0842|FLJ13612|MST133|MSTP133|PP3051
Gene description: EF-hand domain family, member D1
Genbank accession: NM_025202
Immunogen: EFHD1 (NP_079478.1, 168 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN
Protein accession: NP_079478.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080303-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00080303-M05-1-1-1.jpg
Application image note: EFHD1 monoclonal antibody (M05), clone 1H7 Western Blot analysis of EFHD1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EFHD1 monoclonal antibody (M05), clone 1H7 now

Add to cart