pp9099 monoclonal antibody (M03), clone 3D9 View larger

pp9099 monoclonal antibody (M03), clone 3D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of pp9099 monoclonal antibody (M03), clone 3D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about pp9099 monoclonal antibody (M03), clone 3D9

Brand: Abnova
Reference: H00080301-M03
Product name: pp9099 monoclonal antibody (M03), clone 3D9
Product description: Mouse monoclonal antibody raised against a partial recombinant pp9099.
Clone: 3D9
Isotype: IgG1 Kappa
Gene id: 80301
Gene name: PLEKHO2
Gene alias: DKFZp761K2312|FLJ38884|PLEKHQ1|PP1628|pp9099
Gene description: pleckstrin homology domain containing, family O member 2
Genbank accession: NM_025201
Immunogen: pp9099 (NP_079477, 392 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GDLLGEGPRHPLQPRERLYRAQLEVKVASEQTEKLLNKVLGSEPAPVSAETLLSQAVEQLRQATQVLQEMRDLGELSQEAPGLREKRKELVTLYRRSAP
Protein accession: NP_079477
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080301-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080301-M03-1-6-1.jpg
Application image note: pp9099 monoclonal antibody (M03), clone 3D9 Western Blot analysis of pp9099 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy pp9099 monoclonal antibody (M03), clone 3D9 now

Add to cart