CDK5RAP3 monoclonal antibody (M01), clone 1G4 View larger

CDK5RAP3 monoclonal antibody (M01), clone 1G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDK5RAP3 monoclonal antibody (M01), clone 1G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about CDK5RAP3 monoclonal antibody (M01), clone 1G4

Brand: Abnova
Reference: H00080279-M01
Product name: CDK5RAP3 monoclonal antibody (M01), clone 1G4
Product description: Mouse monoclonal antibody raised against a full length recombinant CDK5RAP3.
Clone: 1G4
Isotype: IgG1 Kappa
Gene id: 80279
Gene name: CDK5RAP3
Gene alias: C53|HSF-27|IC53|LZAP|MST016|OK/SW-cl.114
Gene description: CDK5 regulatory subunit associated protein 3
Genbank accession: BC009957
Immunogen: CDK5RAP3 (AAH09957, 1 a.a. ~ 506 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL
Protein accession: AAH09957
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00080279-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (81.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080279-M01-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CDK5RAP3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Suppression of the novel ER protein Maxer by mutant ataxin-1 in Bergman glia contributes to non-cell-autonomous toxicity.Shiwaku H, Yoshimura N, Tamura T, Sone M, Ogishima S, Watase K, Tagawa K, Okazawa H.
EMBO J. 2010 Jun 8. [Epub ahead of print]

Reviews

Buy CDK5RAP3 monoclonal antibody (M01), clone 1G4 now

Add to cart