GRPEL1 monoclonal antibody (M03), clone 3F10 View larger

GRPEL1 monoclonal antibody (M03), clone 3F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GRPEL1 monoclonal antibody (M03), clone 3F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about GRPEL1 monoclonal antibody (M03), clone 3F10

Brand: Abnova
Reference: H00080273-M03
Product name: GRPEL1 monoclonal antibody (M03), clone 3F10
Product description: Mouse monoclonal antibody raised against a partial recombinant GRPEL1.
Clone: 3F10
Isotype: IgG2a Kappa
Gene id: 80273
Gene name: GRPEL1
Gene alias: FLJ25609|HMGE
Gene description: GrpE-like 1, mitochondrial (E. coli)
Genbank accession: NM_025196
Immunogen: GRPEL1 (NP_079472.1, 118 a.a. ~ 217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
Protein accession: NP_079472.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00080273-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged GRPEL1 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy GRPEL1 monoclonal antibody (M03), clone 3F10 now

Add to cart