Brand: | Abnova |
Reference: | H00080273-M03 |
Product name: | GRPEL1 monoclonal antibody (M03), clone 3F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GRPEL1. |
Clone: | 3F10 |
Isotype: | IgG2a Kappa |
Gene id: | 80273 |
Gene name: | GRPEL1 |
Gene alias: | FLJ25609|HMGE |
Gene description: | GrpE-like 1, mitochondrial (E. coli) |
Genbank accession: | NM_025196 |
Immunogen: | GRPEL1 (NP_079472.1, 118 a.a. ~ 217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA |
Protein accession: | NP_079472.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GRPEL1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |